PFKFB4 anticorps (N-Term)
-
- Antigène Voir toutes PFKFB4 Anticorps
- PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PFKFB4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PFKFB4 antibody was raised against the N terminal of PFKFB4
- Purification
- Affinity purified
- Immunogène
- PFKFB4 antibody was raised using the N terminal of PFKFB4 corresponding to a region with amino acids MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR
- Top Product
- Discover our top product PFKFB4 Anticorps primaire
-
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (AA 266-296) antibody
PFKFB4 Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB04059 unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) antibodyPFKFB4 Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) antibodyPFKFB4 Reactivité: Humain WB, IF Hôte: Souris Monoclonal 1C8 unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (AA 274-303) antibodyPFKFB4 Reactivité: Humain, Souris WB, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (AA 266-368) antibodyPFKFB4 Reactivité: Humain ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (N-Term) antibodyPFKFB4 Reactivité: Humain, Souris, Rat, Chien, Cobaye, Cheval, Lapin, Poisson zèbre (Danio rerio), Boeuf (Vache), Porc, Roussette (Chauve-souris), Hamster, Singe, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (N-Term) antibodyPFKFB4 Reactivité: Humain, Souris, Rat, Chien, Cobaye, Cheval, Lapin, Poisson zèbre (Danio rerio), Boeuf (Vache) WB Hôte: Lapin Polyclonal unconjugated
anti-6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4) (AA 266-296) antibodyPFKFB4 Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PFKFB4 Blocking Peptide, catalog no. 33R-5758, is also available for use as a blocking control in assays to test for specificity of this PFKFB4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKFB4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PFKFB4 (6-phosphofructo-2-Kinase/fructose-2,6-Biphosphatase 4 (PFKFB4))
- Autre désignation
- PFKFB4 (PFKFB4 Produits)
- Synonymes
- anticorps MGC69186, anticorps MGC81068, anticorps PFKFB4, anticorps zgc:123288, anticorps C230090D14, anticorps 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4, anticorps 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 S homeolog, anticorps 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4a, anticorps pfkfb4, anticorps pfkfb4.S, anticorps PFKFB4, anticorps pfkfb4a, anticorps f264, anticorps Pfkfb4
- Sujet
- PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.
- Poids moléculaire
- 54 kDa (MW of target protein)
-
