GFOD1 anticorps (Middle Region)

N° du produit ABIN632377

Détail du produit anti-GFOD1 anticorps

Antigène: GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1 (GFOD1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GFOD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GFOD1 antibody was raised against the middle region of GFOD1

Purification: Affinity purified

Immunogène: GFOD1 antibody was raised using the middle region of GFOD1 corresponding to a region with amino acids NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GFOD1 Blocking Peptide, catalog no. 33R-6883, is also available for use as a blocking control in assays to test for specificity of this GFOD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GFOD1

Antigène: GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1 (GFOD1))

Autre désignation: GFOD1 (GFOD1 Produits)

Synonymes: anticorps MGC75800, anticorps gfod1, anticorps ADG-90, anticorps C6orf114, anticorps 9630032O13, anticorps AI850995, anticorps glucose-fructose oxidoreductase domain containing 1, anticorps glucose-fructose oxidoreductase domain-containing protein 1, anticorps si:ch211-276f18.2, anticorps uncharacterized LOC100411032, anticorps Gfod1, anticorps gfod1, anticorps GFOD1, anticorps LOC520966, anticorps si:ch211-276f18.2, anticorps LOC100411032, anticorps LOC100460871

Sujet: The function of GFOD1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 43 kDa (MW of target protein)