GFOD1 anticorps (Middle Region)
-
- Antigène Voir toutes GFOD1 Anticorps
- GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1 (GFOD1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GFOD1 est non-conjugé
- Application
- Western Blotting (WB)
- Specificité
- GFOD1 antibody was raised against the middle region of GFOD1
- Purification
- Affinity purified
- Immunogène
- GFOD1 antibody was raised using the middle region of GFOD1 corresponding to a region with amino acids NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT
- Top Product
- Discover our top product GFOD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GFOD1 Blocking Peptide, catalog no. 33R-6883, is also available for use as a blocking control in assays to test for specificity of this GFOD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFOD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1 (GFOD1))
- Autre désignation
- GFOD1 (GFOD1 Produits)
- Sujet
- The function of GFOD1 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 43 kDa (MW of target protein)
-