ARL17 anticorps (Middle Region)

N° du produit ABIN632378

Détail du produit anti-ARL17 anticorps

Antigène: ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARL17 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARL17 antibody was raised against the middle region of ARL17

Purification: Affinity purified

Immunogène: ARL17 antibody was raised using the middle region of ARL17 corresponding to a region with amino acids KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARL17 Blocking Peptide, catalog no. 33R-4276, is also available for use as a blocking control in assays to test for specificity of this ARL17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARL17

Antigène: ARL17 (ADP-Ribosylation Factor-Like 17B (ARL17))

Autre désignation: ARL17 (ARL17 Produits)

Synonymes: anticorps ARL17, anticorps ARL17A, anticorps ADP ribosylation factor like GTPase 17B, anticorps ARL17B

Sujet: ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking, may modulate vesicle budding and uncoating within the Golgi apparatus.

Poids moléculaire: 19 kDa (MW of target protein)