COPG anticorps (N-Term)

N° du produit ABIN632383

Détail du produit anti-COPG anticorps

Antigène: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COPG est non-conjugé

Application: Western Blotting (WB)

Specificité: COPG antibody was raised against the N terminal of COPG

Purification: Affinity purified

Immunogène: COPG antibody was raised using the N terminal of COPG corresponding to a region with amino acids MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COPG Blocking Peptide, catalog no. 33R-6190, is also available for use as a blocking control in assays to test for specificity of this COPG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COPG

Antigène: COPG (Coatomer Protein Complex, Subunit gamma (COPG))

Autre désignation: COPG (COPG Produits)

Synonymes: anticorps COPG, anticorps COPG2, anticorps AU019265, anticorps BC056168, anticorps Copg, anticorps D6Ertd71e, anticorps D6Wsu16e, anticorps copg1, anticorps MGC76032, anticorps MGC68533, anticorps COPG1, anticorps coatomer protein complex subunit gamma 1, anticorps coatomer protein complex, subunit gamma 1, anticorps coatomer protein complex subunit gamma 1 L homeolog, anticorps coatomer subunit gamma-1, anticorps COPG1, anticorps Copg1, anticorps copg1, anticorps copg1.L, anticorps LOC100050080

Sujet: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Poids moléculaire: 98 kDa (MW of target protein)