HSD17B14 anticorps
-
- Antigène Voir toutes HSD17B14 Anticorps
- HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HSD17B14 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HSD17 B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP
- Top Product
- Discover our top product HSD17B14 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HSD17B14 Blocking Peptide, catalog no. 33R-7670, is also available for use as a blocking control in assays to test for specificity of this HSD17B14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HSD17B14 (Hydroxysteroid (17-Beta) Dehydrogenase 14 (HSD17B14))
- Autre désignation
- HSD17B14 (HSD17B14 Produits)
- Synonymes
- anticorps Dhrs10, anticorps retSDR3, anticorps 0610039E24Rik, anticorps DHRS10, anticorps SDR47C1, anticorps SDR3, anticorps hydroxysteroid (17-beta) dehydrogenase 14, anticorps hydroxysteroid 17-beta dehydrogenase 14, anticorps Hsd17b14, anticorps HSD17B14
- Sujet
- 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.
- Poids moléculaire
- 28 kDa (MW of target protein)
-