LYSMD1 anticorps (N-Term)

N° du produit ABIN632386

Détail du produit anti-LYSMD1 anticorps

Antigène: LYSMD1 (LysM, Putative Peptidoglycan-Binding, Domain Containing 1 (LYSMD1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYSMD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYSMD1 antibody was raised against the N terminal of LYSMD1

Purification: Affinity purified

Immunogène: LYSMD1 antibody was raised using the N terminal of LYSMD1 corresponding to a region with amino acids VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYSMD1 Blocking Peptide, catalog no. 33R-9771, is also available for use as a blocking control in assays to test for specificity of this LYSMD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYSMD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYSMD1

Antigène: LYSMD1 (LysM, Putative Peptidoglycan-Binding, Domain Containing 1 (LYSMD1))

Autre désignation: LYSMD1 (LYSMD1 Produits)

Synonymes: anticorps zgc:153301, anticorps LYSMD1, anticorps RP11-68I18.5, anticorps 2610022K04Rik, anticorps AI415311, anticorps LysM domain containing 1, anticorps LysM, putative peptidoglycan-binding, domain containing 1, anticorps LysM, putative peptidoglycan-binding, domain containing 1 S homeolog, anticorps LYSMD1, anticorps lysmd1, anticorps lysmd1.S, anticorps Lysmd1

Sujet: The function of LYSMD1 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 25 kDa (MW of target protein)