VPS52 anticorps
-
- Antigène Voir toutes VPS52 Anticorps
- VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VPS52 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- VPS52 antibody was raised using a synthetic peptide corresponding to a region with amino acids RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF
- Top Product
- Discover our top product VPS52 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VPS52 Blocking Peptide, catalog no. 33R-8283, is also available for use as a blocking control in assays to test for specificity of this VPS52 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS52 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VPS52 (Vacuolar Protein Sorting 52 Homolog (VPS52))
- Autre désignation
- VPS52 (VPS52 Produits)
- Synonymes
- anticorps ARE1, anticorps RP5-1033B10, anticorps SAC2, anticorps SACM2L, anticorps dJ1033B10.5, anticorps Are1, anticorps Sacm2l, anticorps D130068D18, anticorps D430041K17Rik, anticorps fb94c11, anticorps sacm2l, anticorps wu:fb94c11, anticorps VPS52, GARP complex subunit, anticorps VPS52 GARP complex subunit, anticorps vacuolar protein sorting 52 homolog (S. cerevisiae), anticorps VPS52, anticorps Vps52, anticorps vps52
- Sujet
- This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.
- Poids moléculaire
- 82 kDa (MW of target protein)
-