EXOC5 anticorps (N-Term)
-
- Antigène Voir toutes EXOC5 Anticorps
- EXOC5 (Exocyst Complex Component 5 (EXOC5))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EXOC5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EXOC5 antibody was raised against the N terminal of EXOC5
- Purification
- Affinity purified
- Immunogène
- EXOC5 antibody was raised using the N terminal of EXOC5 corresponding to a region with amino acids ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI
- Top Product
- Discover our top product EXOC5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXOC5 Blocking Peptide, catalog no. 33R-1562, is also available for use as a blocking control in assays to test for specificity of this EXOC5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EXOC5 (Exocyst Complex Component 5 (EXOC5))
- Autre désignation
- EXOC5 (EXOC5 Produits)
- Sujet
- The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.
- Poids moléculaire
- 82 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis
-