EXOC5 anticorps (N-Term)

N° du produit ABIN632393

Détail du produit anti-EXOC5 anticorps

Antigène: EXOC5 (Exocyst Complex Component 5 (EXOC5))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOC5 est non-conjugé

Application: Western Blotting (WB)

Specificité: EXOC5 antibody was raised against the N terminal of EXOC5

Purification: Affinity purified

Immunogène: EXOC5 antibody was raised using the N terminal of EXOC5 corresponding to a region with amino acids ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOC5 Blocking Peptide, catalog no. 33R-1562, is also available for use as a blocking control in assays to test for specificity of this EXOC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOC5

Antigène: EXOC5 (Exocyst Complex Component 5 (EXOC5))

Autre désignation: EXOC5 (EXOC5 Produits)

Synonymes: anticorps CG6159, anticorps Dmel\\CG6159, anticorps P71, anticorps Sec10, anticorps Sec10p, anticorps dSec10, anticorps dsec10, anticorps SEC10L1, anticorps MGC80624, anticorps sec10l1, anticorps zgc:175220, anticorps HSEC10, anticorps PRO1912, anticorps SEC10, anticorps SEC10P, anticorps AI447711, anticorps AI448003, anticorps Gm76, anticorps Sec10l1, anticorps exocyst complex component sec10, anticorps Secretory 10, anticorps exocyst complex component 5, anticorps exocyst complex component 5 L homeolog, anticorps exocyst complex component sec10, anticorps Exocyst complex component 5, anticorps Sec10, anticorps EXOC5, anticorps exoc5.L, anticorps exoc5, anticorps CpipJ_CPIJ009626, anticorps Tsp_08508, anticorps Tsp_12387, anticorps Exoc5, anticorps SEC10, anticorps sec-10

Sujet: The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.

Poids moléculaire: 82 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Vesicle Exocytosis