ICA1 anticorps (C-Term)

N° du produit ABIN632403

Détail du produit anti-ICA1 anticorps

Antigène: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ICA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ICA1 antibody was raised against the C terminal of ICA1

Purification: Affinity purified

Immunogène: ICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ICA1 Blocking Peptide, catalog no. 33R-6795, is also available for use as a blocking control in assays to test for specificity of this ICA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ICA1

Antigène: ICA1 (Islet Cell Autoantigen 1, 69kDa (ICA1))

Autre désignation: ICA1 (ICA1 Produits)

Synonymes: anticorps ica1, anticorps MGC52730, anticorps ICA1, anticorps DKFZp469G0321, anticorps zgc:92566, anticorps 69kDa, anticorps ICA69, anticorps Ica69, anticorps MGC83241, anticorps ICAp69, anticorps islet cell autoantigen 1 L homeolog, anticorps islet cell autoantigen 1, anticorps Islet cell autoantigen 1, anticorps islet cell autoantigen 1 S homeolog, anticorps ica1.L, anticorps ICA1, anticorps ica1, anticorps ica69, anticorps Ica1, anticorps ica1.S

Sujet: ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome.

Poids moléculaire: 53 kDa (MW of target protein)