COPG2 anticorps (N-Term)

N° du produit ABIN632404

Détail du produit anti-COPG2 anticorps

Antigène: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COPG2 est non-conjugé

Application: Western Blotting (WB)

Specificité: COPG2 antibody was raised against the N terminal of COPG2

Purification: Affinity purified

Immunogène: COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COPG2 Blocking Peptide, catalog no. 33R-6111, is also available for use as a blocking control in assays to test for specificity of this COPG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COPG2

Antigène: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Autre désignation: COPG2 (COPG2 Produits)

Synonymes: anticorps 2-COP, anticorps cb943, anticorps copg, anticorps fi31b06, anticorps wu:fi31b06, anticorps AW227625, anticorps gamma-2-COP, anticorps COPG, anticorps COPG2, anticorps MGC83366, anticorps MGC79509, anticorps RGD1566215, anticorps coatomer protein complex subunit gamma 2, anticorps coatomer protein complex, subunit gamma 2, anticorps coatomer protein complex subunit gamma 1, anticorps coatomer protein complex subunit gamma 2 S homeolog, anticorps coatomer subunit gamma-2, anticorps COPG2, anticorps copg2, anticorps Copg2, anticorps COPG1, anticorps copg2.S, anticorps LOC100068740, anticorps LOC100560095, anticorps LOC100594709

Sujet: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Poids moléculaire: 97 kDa (MW of target protein)