COPG2 anticorps (N-Term)
-
- Antigène Voir toutes COPG2 Anticorps
- COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp COPG2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- COPG2 antibody was raised against the N terminal of COPG2
- Purification
- Affinity purified
- Immunogène
- COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK
- Top Product
- Discover our top product COPG2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
COPG2 Blocking Peptide, catalog no. 33R-6111, is also available for use as a blocking control in assays to test for specificity of this COPG2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))
- Autre désignation
- COPG2 (COPG2 Produits)
- Sujet
- The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.
- Poids moléculaire
- 97 kDa (MW of target protein)
-