TMED8 anticorps (Middle Region)

N° du produit ABIN632407

Détail du produit anti-TMED8 anticorps

Antigène: TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMED8 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMED8 antibody was raised against the middle region of TMED8

Purification: Affinity purified

Immunogène: TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMED8 Blocking Peptide, catalog no. 33R-2466, is also available for use as a blocking control in assays to test for specificity of this TMED8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMED8

Antigène: TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))

Autre désignation: TMED8 (TMED8 Produits)

Synonymes: anticorps 6430595O10Rik, anticorps AI447224, anticorps Gm1184, anticorps Mem1, anticorps FAM15B, anticorps zgc:112014, anticorps transmembrane p24 trafficking protein 8, anticorps transmembrane p24 trafficking protein family member 8, anticorps Tmed8, anticorps TMED8, anticorps tmed8

Sujet: The function of TMED8 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 36 kDa (MW of target protein)