TMED8 anticorps (Middle Region)
-
- Antigène Tous les produits TMED8
- TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMED8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMED8 antibody was raised against the middle region of TMED8
- Purification
- Affinity purified
- Immunogène
- TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMED8 Blocking Peptide, catalog no. 33R-2466, is also available for use as a blocking control in assays to test for specificity of this TMED8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMED8 (Transmembrane Emp24 Protein Transport Domain Containing 8 (TMED8))
- Autre désignation
- TMED8 (TMED8 Produits)
- Synonymes
- anticorps 6430595O10Rik, anticorps AI447224, anticorps Gm1184, anticorps Mem1, anticorps FAM15B, anticorps zgc:112014, anticorps transmembrane p24 trafficking protein 8, anticorps transmembrane p24 trafficking protein family member 8, anticorps Tmed8, anticorps TMED8, anticorps tmed8
- Sujet
- The function of TMED8 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 36 kDa (MW of target protein)
-