SH3GL1 anticorps (N-Term)

N° du produit ABIN632409

Détail du produit anti-SH3GL1 anticorps

Antigène: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3GL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SH3 GL1 antibody was raised against the N terminal of SH3 L1

Purification: Affinity purified

Immunogène: SH3 GL1 antibody was raised using the N terminal of SH3 L1 corresponding to a region with amino acids LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3GL1 Blocking Peptide, catalog no. 33R-5248, is also available for use as a blocking control in assays to test for specificity of this SH3GL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 L1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3GL1

Antigène: SH3GL1 (SH3-Domain GRB2-Like 1 (SH3GL1))

Autre désignation: SH3GL1 (SH3GL1 Produits)

Synonymes: anticorps CNSA1, anticorps EEN, anticorps SH3D2B, anticorps SH3P8, anticorps C77078, anticorps Sh3d2b, anticorps cb831, anticorps sh3gl1, anticorps MGC78966, anticorps MGC130739, anticorps sh3gl1b, anticorps wu:fd12b05, anticorps wu:fy33c10, anticorps zgc:56637, anticorps SH3 domain containing GRB2 like 1, endophilin A2, anticorps SH3-domain GRB2-like 1, anticorps SH3-domain GRB2-like 1b, anticorps SH3-domain GRB2-like 1 L homeolog, anticorps SH3-domain GRB2-like 1a, anticorps SH3GL1, anticorps Sh3gl1, anticorps sh3gl1b, anticorps sh3gl1.L, anticorps sh3gl1, anticorps sh3gl1a

Sujet: SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Poids moléculaire: 41 kDa (MW of target protein)