VTA1 anticorps
-
- Antigène Voir toutes VTA1 Anticorps
- VTA1 (Vps20-Associated 1 Homolog (VTA1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VTA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
- Top Product
- Discover our top product VTA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VTA1 Blocking Peptide, catalog no. 33R-4488, is also available for use as a blocking control in assays to test for specificity of this VTA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VTA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VTA1 (Vps20-Associated 1 Homolog (VTA1))
- Autre désignation
- VTA1 (VTA1 Produits)
- Synonymes
- anticorps C6orf55, anticorps DRG-1, anticorps DRG1, anticorps LIP5, anticorps My012, anticorps SBP1, anticorps 1110001D18Rik, anticorps 1110059P08Rik, anticorps AU040813, anticorps C85340, anticorps Lip5, anticorps RGD1305031, anticorps Vps20-associated 1 homolog, anticorps vesicle trafficking 1, anticorps vesicle (multivesicular body) trafficking 1, anticorps Vta1, anticorps VTA1
- Sujet
- C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.
- Poids moléculaire
- 34 kDa (MW of target protein)
-