TPPP3 anticorps (N-Term)
-
- Antigène Voir toutes TPPP3 Anticorps
- TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TPPP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TPPP3 antibody was raised against the N terminal of TPPP3
- Purification
- Affinity purified
- Immunogène
- TPPP3 antibody was raised using the N terminal of TPPP3 corresponding to a region with amino acids MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSV
- Top Product
- Discover our top product TPPP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TPPP3 Blocking Peptide, catalog no. 33R-5611, is also available for use as a blocking control in assays to test for specificity of this TPPP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPPP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TPPP3 (Tubulin Polymerization-Promoting Protein Family Member 3 (TPPP3))
- Autre désignation
- TPPP3 (TPPP3 Produits)
- Synonymes
- anticorps p20, anticorps p25gamma, anticorps 2700055K07Rik, anticorps CGI-38, anticorps Ceacam9, anticorps mmCGM8, anticorps RGD1305061, anticorps tubulin polymerization promoting protein family member 3, anticorps tubulin polymerization-promoting protein family member 3, anticorps tubulin polymerization-promoting protein family member 3 L homeolog, anticorps TPPP3, anticorps Tppp3, anticorps tppp3.L
- Sujet
- TPPP3 belongs to the TPPP family. This protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. The function of TPPP3 remains unknown.
- Poids moléculaire
- 19 kDa (MW of target protein)
-