C1orf116 anticorps (Middle Region)

N° du produit ABIN632417

Détail du produit anti-C1orf116 anticorps

Antigène: C1orf116 (c1orf116) (Chromosome 1 Open Reading Frame 116 (c1orf116))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1orf116 est non-conjugé

Application: Western Blotting (WB)

Specificité: C1 ORF116 antibody was raised against the middle region of C1 rf116

Purification: Affinity purified

Immunogène: C1 ORF116 antibody was raised using the middle region of C1 rf116 corresponding to a region with amino acids SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C1ORF116 Blocking Peptide, catalog no. 33R-8474, is also available for use as a blocking control in assays to test for specificity of this C1ORF116 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF116 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1orf116

Antigène: C1orf116 (c1orf116) (Chromosome 1 Open Reading Frame 116 (c1orf116))

Autre désignation: C1ORF116 (c1orf116 Produits)

Synonymes: anticorps SARG, anticorps C26H1orf116, anticorps E030025M07, anticorps Sarg, anticorps chromosome 1 open reading frame 116, anticorps chromosome 16 open reading frame, human C1orf116, anticorps chromosome 26 C1orf116 homolog, anticorps expressed sequence AA986860, anticorps similar to specifically androgen-regulated protein, anticorps c1orf116, anticorps C1orf116, anticorps C16H1orf116, anticorps C26H1orf116, anticorps AA986860, anticorps LOC498222

Sujet: C1orf116 belongs to the SARG family. It is a putative androgen-specific receptor. It is highly expressed in prostate.

Poids moléculaire: 37 kDa (MW of target protein)