SH3BGRL anticorps (Middle Region)

N° du produit ABIN632421

Détail du produit anti-SH3BGRL anticorps

Antigène: SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3BGRL est non-conjugé

Application: Western Blotting (WB)

Specificité: SH3 BGRL antibody was raised against the middle region of SH3 GRL

Purification: Affinity purified

Immunogène: SH3 BGRL antibody was raised using the middle region of SH3 GRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3BGRL Blocking Peptide, catalog no. 33R-7300, is also available for use as a blocking control in assays to test for specificity of this SH3BGRL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GRL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3BGRL

Antigène: SH3BGRL (SH3 Domain Binding Glutamic Acid-Rich Protein Like (SH3BGRL))

Autre désignation: SH3BGRL (SH3BGRL Produits)

Synonymes: anticorps sh3bgr, anticorps SH3BGR, anticorps 1190008F14Rik, anticorps SH3BGRL, anticorps RGD1560520, anticorps SH3 domain binding glutamate-rich protein like L homeolog, anticorps SH3 domain binding glutamate rich protein like, anticorps SH3-binding domain glutamic acid-rich protein like, anticorps SH3 domain binding glutamate-rich protein like, anticorps SH3 domain binding glutamic acid-rich protein like, anticorps sh3bgrl.L, anticorps SH3BGRL, anticorps Sh3bgrl, anticorps sh3bgrl

Sujet: SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.

Poids moléculaire: 13 kDa (MW of target protein)