RD3 anticorps (N-Term)

N° du produit ABIN632425

Détail du produit anti-RD3 anticorps

Antigène: RD3 (Retinal Degeneration 3 (RD3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RD3 est non-conjugé

Application: Western Blotting (WB)

Specificité: RD3 antibody was raised against the N terminal of RD3

Purification: Affinity purified

Immunogène: RD3 antibody was raised using the N terminal of RD3 corresponding to a region with amino acids GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RD3 Blocking Peptide, catalog no. 33R-3503, is also available for use as a blocking control in assays to test for specificity of this RD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RD3

Antigène: RD3 (Retinal Degeneration 3 (RD3))

Autre désignation: RD3 (RD3 Produits)

Synonymes: anticorps C1orf36, anticorps LCA12, anticorps 3322402L07Rik, anticorps rd-3, anticorps rd3, anticorps retinal degeneration 3, anticorps RD3, anticorps Rd3

Sujet: RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Poids moléculaire: 23 kDa (MW of target protein)