GLRX5 anticorps (Middle Region)

N° du produit ABIN632427

Détail du produit anti-GLRX5 anticorps

Antigène: GLRX5 (Glutaredoxin 5 (GLRX5))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLRX5 est non-conjugé

Application: Western Blotting (WB)

Specificité: GLRX5 antibody was raised against the middle region of GLRX5

Purification: Affinity purified

Immunogène: GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLRX5 Blocking Peptide, catalog no. 33R-6648, is also available for use as a blocking control in assays to test for specificity of this GLRX5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLRX5

Antigène: GLRX5 (Glutaredoxin 5 (GLRX5))

Autre désignation: GLRX5 (GLRX5 Produits)

Synonymes: anticorps grx5, anticorps C14orf87, anticorps FLB4739, anticorps GRX5, anticorps PR01238, anticorps PRO1238, anticorps RGD1308383, anticorps 2310004O13Rik, anticorps 2900070E19Rik, anticorps AU020725, anticorps id:ibd5119, anticorps wu:fa09g08, anticorps zgc:73343, anticorps glutaredoxin 5 L homeolog, anticorps glutaredoxin 5, anticorps glutaredoxin 5 homolog (S. cerevisiae), anticorps glrx5.L, anticorps GLRX5, anticorps Glrx5, anticorps glrx5

Sujet: Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis