COBLL1 anticorps (N-Term)
-
- Antigène Tous les produits COBLL1
- COBLL1 (COBL-Like 1 (COBLL1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Chien, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp COBLL1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Cobl-Like 1 antibody was raised against the N terminal of COBLL1
- Purification
- Affinity purified
- Immunogène
- Cobl-Like 1 antibody was raised using the N terminal of COBLL1 corresponding to a region with amino acids SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cobl-Like 1 Blocking Peptide, catalog no. 33R-8308, is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COBLL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- COBLL1 (COBL-Like 1 (COBLL1))
- Autre désignation
- Cobl-Like 1 (COBLL1 Produits)
- Sujet
- The function of this gene remains unknown.
- Poids moléculaire
- 128 kDa (MW of target protein)
-