Exophilin 5 anticorps (Middle Region)
-
- Antigène Voir toutes Exophilin 5 (EXPH5) Anticorps
- Exophilin 5 (EXPH5)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Exophilin 5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EXPH5 antibody was raised against the middle region of EXPH5
- Purification
- Affinity purified
- Immunogène
- EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL
- Top Product
- Discover our top product EXPH5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXPH5 Blocking Peptide, catalog no. 33R-7572, is also available for use as a blocking control in assays to test for specificity of this EXPH5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXPH5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Exophilin 5 (EXPH5)
- Autre désignation
- EXPH5 (EXPH5 Produits)
- Synonymes
- anticorps RGD1560308, anticorps AC079869.22gm5, anticorps B130009M24Rik, anticorps E030050P12, anticorps Kiaa0624, anticorps Slac2b, anticorps slac2-b, anticorps DKFZp469K2410, anticorps SLAC2-B, anticorps SLAC2B, anticorps exophilin 5, anticorps Exph5, anticorps EXPH5
- Sujet
- EXPH5 may act as a Rab effector protein and play a role in vesicle trafficking.
- Poids moléculaire
- 222 kDa (MW of target protein)
-