GTPBP2 anticorps (N-Term)
-
- Antigène Voir toutes GTPBP2 Anticorps
- GTPBP2 (GTP Binding Protein 2 (GTPBP2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GTPBP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GTPBP2 antibody was raised against the N terminal of GTPBP2
- Purification
- Affinity purified
- Immunogène
- GTPBP2 antibody was raised using the N terminal of GTPBP2 corresponding to a region with amino acids GCGGPKGKKKNGRNRGGKANNPPYLPPEAEDGNIEYKLKLVNPSQYRFEH
- Top Product
- Discover our top product GTPBP2 Anticorps primaire
-
anti-GTP Binding Protein 2 (GTPBP2) (AA 536-564), (C-Term) antibody
GTPBP2 Reactivité: Humain, Souris, Hamster WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB24638 unconjugated
anti-GTP Binding Protein 2 (GTPBP2) (AA 1-602) antibodyGTPBP2 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-GTP Binding Protein 2 (GTPBP2) (AA 35-84) antibodyGTPBP2 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Cheval, Poisson zèbre (Danio rerio), Singe, Roussette (Chauve-souris), Poulet WB Hôte: Lapin Polyclonal unconjugated
anti-GTP Binding Protein 2 (GTPBP2) (N-Term) antibodyGTPBP2 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Cheval, Chévre, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
anti-GTP Binding Protein 2 (GTPBP2) (AA 543-572), (C-Term) antibodyGTPBP2 Reactivité: Humain, Souris, Hamster WB, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
anti-GTP Binding Protein 2 (GTPBP2) antibodyGTPBP2 Reactivité: Humain IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-GTP Binding Protein 2 (GTPBP2) (AA 1-250) antibodyGTPBP2 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-GTP Binding Protein 2 (GTPBP2) (AA 511-560) antibodyGTPBP2 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Cheval, Lapin, Singe, Roussette (Chauve-souris), Porc WB Hôte: Lapin Polyclonal unconjugated
anti-GTP Binding Protein 2 (GTPBP2) (C-Term) antibodyGTPBP2 Reactivité: Humain, Souris, Rat, Chien WB Hôte: Lapin Polyclonal unconjugated
anti-GTP Binding Protein 2 (GTPBP2) (AA 1-179) antibodyGTPBP2 Reactivité: Humain, Rat WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GTPBP2 Blocking Peptide, catalog no. 33R-3185, is also available for use as a blocking control in assays to test for specificity of this GTPBP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GTPBP2 (GTP Binding Protein 2 (GTPBP2))
- Autre désignation
- GTPBP2 (GTPBP2 Produits)
- Synonymes
- anticorps si:ch211-151i8.2, anticorps si:dkeyp-34c12.3, anticorps GB1, anticorps ZGB1, anticorps GTP binding protein 2, anticorps GTP binding protein 2 L homeolog, anticorps GTP binding protein 2b, anticorps GTPBP2, anticorps Gtpbp2, anticorps gtpbp2.L, anticorps gtpbp2b, anticorps gbp2
- Sujet
- GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.
- Poids moléculaire
- 66 kDa (MW of target protein)
-
