Chromosome 6 Open Reading Frame 134 (C6orf134) (Middle Region) anticorps
-
- Antigène Voir toutes Chromosome 6 Open Reading Frame 134 (C6orf134) Anticorps
- Chromosome 6 Open Reading Frame 134 (C6orf134)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- C6 ORF134 antibody was raised against the middle region of C6 rf134
- Purification
- Affinity purified
- Immunogène
- C6 ORF134 antibody was raised using the middle region of C6 rf134 corresponding to a region with amino acids DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID
- Top Product
- Discover our top product C6orf134 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C6ORF134 Blocking Peptide, catalog no. 33R-1888, is also available for use as a blocking control in assays to test for specificity of this C6ORF134 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF134 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Chromosome 6 Open Reading Frame 134 (C6orf134)
- Autre désignation
- C6ORF134 (C6orf134 Produits)
- Synonymes
- anticorps C6orf134, anticorps MEC17, anticorps Nbla00487, anticorps TAT, anticorps mec17, anticorps wu:fj19c03, anticorps zgc:65893, anticorps zgc:77443, anticorps Alpha-TAT, anticorps c6orf134, anticorps C23H6orf134, anticorps 0610011P08Rik, anticorps 2610008K08Rik, anticorps 2610110G12Rik, anticorps 3110080J08Rik, anticorps Mec17, anticorps RGD1303066, anticorps C7H6ORF134, anticorps C4H6orf134, anticorps alpha tubulin acetyltransferase 1, anticorps alpha tubulin acetyltransferase 1 S homeolog, anticorps ATAT1, anticorps atat1, anticorps atat1.S, anticorps Atat1
- Sujet
- The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 36 kDa (MW of target protein)
-