RPRD1B anticorps (Middle Region)
-
- Antigène Voir toutes RPRD1B Anticorps
- RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RPRD1B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RPRD1 B antibody was raised against the middle region of RPRD1
- Purification
- Affinity purified
- Immunogène
- RPRD1 B antibody was raised using the middle region of RPRD1 corresponding to a region with amino acids KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS
- Top Product
- Discover our top product RPRD1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RPRD1B Blocking Peptide, catalog no. 33R-4494, is also available for use as a blocking control in assays to test for specificity of this RPRD1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPRD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))
- Autre désignation
- RPRD1B (RPRD1B Produits)
- Synonymes
- anticorps fb23h08, anticorps zgc:55687, anticorps wu:fb23h08, anticorps rprd1ba, anticorps MGC130705, anticorps C13H20ORF77, anticorps C20orf77, anticorps CREPT, anticorps NET60, anticorps dJ1057B20.2, anticorps 2610304G08Rik, anticorps 2810446G03Rik, anticorps Crept, anticorps RGD1304782, anticorps regulation of nuclear pre-mRNA domain containing 1B, anticorps regulation of nuclear pre-mRNA domain containing 1B L homeolog, anticorps rprd1b, anticorps rprd1b.L, anticorps RPRD1B, anticorps Rprd1b
- Sujet
- The function of RPRD1B protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 37 kDa (MW of target protein)
-