CMTR2 anticorps (Middle Region)

N° du produit ABIN632447

Détail du produit anti-CMTR2 anticorps

Antigène: CMTR2 (Cap Methyltransferase 2 (CMTR2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CMTR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: FTSJD1 antibody was raised against the middle region of FTSJD1

Purification: Affinity purified

Immunogène: FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FTSJD1 Blocking Peptide, catalog no. 33R-5216, is also available for use as a blocking control in assays to test for specificity of this FTSJD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CMTR2

Antigène: CMTR2 (Cap Methyltransferase 2 (CMTR2))

Autre désignation: FTSJD1 (CMTR2 Produits)

Synonymes: anticorps AFT, anticorps FTSJD1, anticorps MTr2, anticorps cap methyltransferase 2, anticorps CMTR2

Sujet: The function of FTSJ protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 88 kDa (MW of target protein)