FAM83E anticorps (Middle Region)

N° du produit ABIN632448

Détail du produit anti-FAM83E anticorps

Antigène: FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM83E est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM83 E antibody was raised against the middle region of FAM83

Purification: Affinity purified

Immunogène: FAM83 E antibody was raised using the middle region of FAM83 corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM83E Blocking Peptide, catalog no. 33R-7823, is also available for use as a blocking control in assays to test for specificity of this FAM83E antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM83E

Antigène: FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))

Autre désignation: FAM83E (FAM83E Produits)

Synonymes: anticorps 4930403C10Rik, anticorps family with sequence similarity 83 member E, anticorps family with sequence similarity 83, member E, anticorps FAM83E, anticorps Fam83e

Sujet: The function of FAM83 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 52 kDa (MW of target protein)