GBX1 anticorps (Middle Region)

N° du produit ABIN632458

Détail du produit anti-GBX1 anticorps

Antigène: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Épitope: Middle Region

Reactivité: Souris, Humain, Rat, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GBX1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GBX1 antibody was raised against the middle region of Gbx-1

Purification: Affinity purified

Immunogène: GBX1 antibody was raised using the middle region of Gbx-1 corresponding to a region with amino acids AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GBX1 Blocking Peptide, catalog no. 33R-1314, is also available for use as a blocking control in assays to test for specificity of this GBX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBX-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GBX1

Antigène: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Autre désignation: GBX1 (GBX1 Produits)

Synonymes: anticorps Huh-17, anticorps Gbx-1, anticorps CHOX-7, anticorps GBX-1, anticorps cb619, anticorps fj77a06, anticorps wu:fj77a06, anticorps gastrulation brain homeobox 1, anticorps GBX1, anticorps Gbx1, anticorps gbx1

Sujet: GBX-1 contains 1 homeobox DNA-binding domain. The exact functions of GBX-1 remain unknown.

Poids moléculaire: 40 kDa (MW of target protein)