C3orf24 anticorps (Middle Region)
-
- Antigène Voir toutes C3orf24 Anticorps
- C3orf24 (Chromosome 3 Open Reading Frame 24 (C3orf24))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C3orf24 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C3 ORF24 antibody was raised against the middle region of C3 rf24
- Purification
- Affinity purified
- Immunogène
- C3 ORF24 antibody was raised using the middle region of C3 rf24 corresponding to a region with amino acids KLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRV
- Top Product
- Discover our top product C3orf24 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C3ORF24 Blocking Peptide, catalog no. 33R-4525, is also available for use as a blocking control in assays to test for specificity of this C3ORF24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C3orf24 (Chromosome 3 Open Reading Frame 24 (C3orf24))
- Autre désignation
- C3ORF24 (C3orf24 Produits)
- Synonymes
- anticorps C3orf24, anticorps RGD1565997, anticorps FANCD2 opposite strand L homeolog, anticorps FANCD2 opposite strand, anticorps fancd2os.L, anticorps FANCD2OS, anticorps fancd2os, anticorps Fancd2os
- Sujet
- The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 20 kDa (MW of target protein)
-