FAM124A anticorps (Middle Region)

N° du produit ABIN632463

Détail du produit anti-FAM124A anticorps

Antigène: FAM124A (Family with Sequence Similarity 124A (FAM124A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM124A est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM124 A antibody was raised against the middle region of FAM124

Purification: Affinity purified

Immunogène: FAM124 A antibody was raised using the middle region of FAM124 corresponding to a region with amino acids VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM124A Blocking Peptide, catalog no. 33R-9824, is also available for use as a blocking control in assays to test for specificity of this FAM124A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM124A

Antigène: FAM124A (Family with Sequence Similarity 124A (FAM124A))

Autre désignation: FAM124A (FAM124A Produits)

Synonymes: anticorps family with sequence similarity 124 member A, anticorps FAM124A

Sujet: The function of FAM124A protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 64 kDa (MW of target protein)