C9orf25 anticorps (Middle Region)

N° du produit ABIN632464

Détail du produit anti-C9orf25 anticorps

Antigène: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C9orf25 est non-conjugé

Application: Western Blotting (WB)

Specificité: C9 ORF25 antibody was raised against the middle region of C9 rf25

Purification: Affinity purified

Immunogène: C9 ORF25 antibody was raised using the middle region of C9 rf25 corresponding to a region with amino acids SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C9ORF25 Blocking Peptide, catalog no. 33R-8849, is also available for use as a blocking control in assays to test for specificity of this C9ORF25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C9orf25

Antigène: C9orf25 (Chromosome 9 Open Reading Frame 25 (C9orf25))

Autre désignation: C9ORF25 (C9orf25 Produits)

Synonymes: anticorps C9orf25, anticorps bA573M23.5, anticorps C15H9orf25, anticorps 2310028H24Rik, anticorps fam219a, anticorps zgc:101028, anticorps family with sequence similarity 219 member A, anticorps family with sequence similarity 219, member A, anticorps family with sequence similarity 219, member Aa, anticorps FAM219A, anticorps Fam219a, anticorps fam219aa

Sujet: The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus.

Poids moléculaire: 18 kDa (MW of target protein)