PMM1 anticorps (N-Term)

N° du produit ABIN632467

Détail du produit anti-PMM1 anticorps

Antigène: PMM1 (Phosphomannomutase 1 (PMM1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PMM1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PMM1 antibody was raised against the N terminal of PMM1

Purification: Affinity purified

Immunogène: PMM1 antibody was raised using the N terminal of PMM1 corresponding to a region with amino acids MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PMM1 Blocking Peptide, catalog no. 33R-5802, is also available for use as a blocking control in assays to test for specificity of this PMM1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PMM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PMM1

Antigène: PMM1 (Phosphomannomutase 1 (PMM1))

Autre désignation: PMM1 (PMM1 Produits)

Synonymes: anticorps Sec53, anticorps C77612, anticorps phosphomannomutase 1, anticorps phosphomannomutase 1 L homeolog, anticorps PMM1, anticorps pmm1, anticorps Pmm1, anticorps pmm1.L

Sujet: Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

Poids moléculaire: 30 kDa (MW of target protein)