FAM135B anticorps (Middle Region)
-
- Antigène Tous les produits FAM135B
- FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FAM135B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FAM135 B antibody was raised against the middle region of FAM135
- Purification
- Affinity purified
- Immunogène
- FAM135 B antibody was raised using the middle region of FAM135 corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FAM135B Blocking Peptide, catalog no. 33R-9192, is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FAM135B (Family with Sequence Similarity 135, Member B (FAM135B))
- Autre désignation
- FAM135B (FAM135B Produits)
- Synonymes
- anticorps MGC81353, anticorps C8ORFK32, anticorps RGD1308133, anticorps 1700010C24Rik, anticorps A830008O07Rik, anticorps family with sequence similarity 135 member B, anticorps family with sequence similarity 135 member B L homeolog, anticorps family with sequence similarity 135, member B, anticorps FAM135B, anticorps fam135b.L, anticorps Fam135b
- Sujet
- The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 156 kDa (MW of target protein)
-