TRAPPC2L anticorps (N-Term)
-
- Antigène Voir toutes TRAPPC2L Anticorps
- TRAPPC2L
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRAPPC2L est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRAPPC2 L antibody was raised against the N terminal of TRAPPC2
- Purification
- Affinity purified
- Immunogène
- TRAPPC2 L antibody was raised using the N terminal of TRAPPC2 corresponding to a region with amino acids MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL
- Top Product
- Discover our top product TRAPPC2L Anticorps primaire
-
anti-TRAPPC2L (AA 1-139) antibody
Reactivité: Humain ELISA, WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-TRAPPC2L (N-Term) antibodyReactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Singe, Xenopus laevis WB Hôte: Lapin Polyclonal unconjugated
anti-TRAPPC2L (N-Term) antibodyReactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Boeuf (Vache), Chien, Cobaye, Cheval WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRAPPC2L Blocking Peptide, catalog no. 33R-5796, is also available for use as a blocking control in assays to test for specificity of this TRAPPC2L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRAPPC2L
- Abstract
- TRAPPC2L Produits
- Sujet
- TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.
- Poids moléculaire
- 16 kDa (MW of target protein)
-
