TRAPPC2L anticorps (N-Term)

N° du produit ABIN632473

Détail du produit anti-TRAPPC2L anticorps

Antigène: TRAPPC2L

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRAPPC2L est non-conjugé

Application: Western Blotting (WB)

Specificité: TRAPPC2 L antibody was raised against the N terminal of TRAPPC2

Purification: Affinity purified

Immunogène: TRAPPC2 L antibody was raised using the N terminal of TRAPPC2 corresponding to a region with amino acids MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRAPPC2L Blocking Peptide, catalog no. 33R-5796, is also available for use as a blocking control in assays to test for specificity of this TRAPPC2L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRAPPC2L

Antigène: TRAPPC2L

Abstract: TRAPPC2L Produits

Synonymes: anticorps HSPC176, anticorps DDBDRAFT_0184526, anticorps DDBDRAFT_0266384, anticorps DDB_0184526, anticorps DDB_0266384, anticorps DKFZp469K0715, anticorps 1810017G16Rik, anticorps AB030200, anticorps Hspc176, anticorps Tca17, anticorps RGD1304906, anticorps zgc:172319, anticorps zgc:92446, anticorps TPC2L, anticorps trappc2l, anticorps trafficking protein particle complex 2 like, anticorps trafficking protein particle complex subunit 2-like protein, anticorps trafficking protein particle complex 2-like, anticorps trafficking protein particle complex 2-like L homeolog, anticorps TRAPPC2L, anticorps trappc2l, anticorps Trappc2l, anticorps LOC106562066, anticorps trappc2l.L

Sujet: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Poids moléculaire: 16 kDa (MW of target protein)