ISPD anticorps (N-Term)

N° du produit ABIN632476

Détail du produit anti-ISPD anticorps

Antigène: ISPD (Isoprenoid Synthase Domain Containing (ISPD))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ISPD est non-conjugé

Application: Western Blotting (WB)

Specificité: HCG_1745121 antibody was raised against the N terminal Of Hcg_1745121

Purification: Affinity purified

Immunogène: HCG_1745121 antibody was raised using the N terminal Of Hcg_1745121 corresponding to a region with amino acids MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HCG_1745121 Blocking Peptide, catalog no. 33R-6558, is also available for use as a blocking control in assays to test for specificity of this HCG_1745121 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HCG_1745121 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ISPD

Antigène: ISPD (Isoprenoid Synthase Domain Containing (ISPD))

Autre désignation: HCG_1745121 (ISPD Produits)

Synonymes: anticorps MDDGA7, anticorps Nip, anticorps 4930579E17Rik, anticorps AV040780, anticorps sb:eu371, anticorps zgc:154151, anticorps isoprenoid synthase domain containing, anticorps ISPD, anticorps ispd, anticorps Ispd

Sujet: The specific function of hCG_1745121 is not yet known.

Poids moléculaire: 44 kDa (MW of target protein)