AHNAK2 anticorps (Middle Region)

N° du produit ABIN632478

Détail du produit anti-AHNAK2 anticorps

Antigène: AHNAK2 (AHNAK Nucleoprotein 2 (AHNAK2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AHNAK2 est non-conjugé

Application: Western Blotting (WB)

Specificité: AHNAK2 antibody was raised against the middle region of AHNAK2

Purification: Affinity purified

Immunogène: AHNAK2 antibody was raised using the middle region of AHNAK2 corresponding to a region with amino acids AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AHNAK2 Blocking Peptide, catalog no. 33R-1056, is also available for use as a blocking control in assays to test for specificity of this AHNAK2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHNAK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AHNAK2

Antigène: AHNAK2 (AHNAK Nucleoprotein 2 (AHNAK2))

Autre désignation: AHNAK2 (AHNAK2 Produits)

Synonymes: anticorps C14orf78, anticorps AI450948, anticorps Gm1185, anticorps Gm72, anticorps RGD1309696, anticorps AHNAK nucleoprotein 2, anticorps AHNAK2, anticorps Ahnak2

Sujet: The specific function of AHNAK2 is not yet known.

Poids moléculaire: 85 kDa (MW of target protein)