CST8 anticorps
-
- Antigène Voir toutes CST8 Anticorps
- CST8 (Cystatin 8 (CST8))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CST8 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- Cystatin 8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY
- Top Product
- Discover our top product CST8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cystatin 8 Blocking Peptide, catalog no. 33R-5097, is also available for use as a blocking control in assays to test for specificity of this Cystatin 8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CST8 (Cystatin 8 (CST8))
- Autre désignation
- Cystatin 8 (CST8 Produits)
- Synonymes
- anticorps CRES, anticorps CTES5, anticorps Cres, anticorps Cst-rs1, anticorps cystatin 8, anticorps cystatin 8 (cystatin-related epididymal spermatogenic), anticorps CST8, anticorps Cst8
- Sujet
- The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens.
- Poids moléculaire
- 14 kDa (MW of target protein)
-