TBC1D16 anticorps (N-Term)

N° du produit ABIN632485

Détail du produit anti-TBC1D16 anticorps

Antigène: TBC1D16 (TBC1 Domain Family, Member 16 (TBC1D16))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TBC1D16 est non-conjugé

Application: Western Blotting (WB)

Specificité: TBC1 D16 antibody was raised against the N terminal of TBC1 16

Purification: Affinity purified

Immunogène: TBC1 D16 antibody was raised using the N terminal of TBC1 16 corresponding to a region with amino acids EMLGATLILAWVPNSRIQRQDEEALRYITPESSPVRKAPRPRGRRTRSSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TBC1D16 Blocking Peptide, catalog no. 33R-2588, is also available for use as a blocking control in assays to test for specificity of this TBC1D16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TBC0 16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TBC1D16

Antigène: TBC1D16 (TBC1 Domain Family, Member 16 (TBC1D16))

Autre désignation: TBC1D16 (TBC1D16 Produits)

Synonymes: anticorps B930087K01, anticorps BC026530, anticorps Tcd1d16, anticorps TBC1 domain family member 16, anticorps TBC1 domain family, member 16, anticorps TBC1D16, anticorps Tbc1d16

Sujet: TBC1D16 may act as a GTPase-activating protein for Rab family proteins.

Poids moléculaire: 86 kDa (MW of target protein)