LRRC2 anticorps (N-Term)
-
- Antigène Voir toutes LRRC2 Anticorps
- LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRRC2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LRRC2 antibody was raised against the N terminal of LRRC2
- Purification
- Affinity purified
- Immunogène
- LRRC2 antibody was raised using the N terminal of LRRC2 corresponding to a region with amino acids GHKVVVFDISVIRALWETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVA
- Top Product
- Discover our top product LRRC2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRRC2 Blocking Peptide, catalog no. 33R-3309, is also available for use as a blocking control in assays to test for specificity of this LRRC2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))
- Autre désignation
- LRRC2 (LRRC2 Produits)
- Synonymes
- anticorps 2400002D05Rik, anticorps 4933431K03Rik, anticorps leucine rich repeat containing 2, anticorps LRRC2, anticorps Lrrc2
- Sujet
- Leucine-rich repeats (LRRs) are 20-29 amino acid motifs that mediate proteinprotein interactions. The primary function of these motifs is to provide a versatile structural framework for the formation of these protein-protein interactions.
- Poids moléculaire
- 43 kDa (MW of target protein)
-