PPP4R2 anticorps (C-Term)

N° du produit ABIN632513

Détail du produit anti-PPP4R2 anticorps

Antigène: PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP4R2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PPP4 R2 antibody was raised against the C terminal of PPP4 2

Purification: Affinity purified

Immunogène: PPP4 R2 antibody was raised using the C terminal of PPP4 2 corresponding to a region with amino acids DSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP4R2 Blocking Peptide, catalog no. 33R-2177, is also available for use as a blocking control in assays to test for specificity of this PPP4R2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP4R2

Antigène: PPP4R2 (Protein Phosphatase 4, Regulatory Subunit 2 (PPP4R2))

Autre désignation: PPP4R2 (PPP4R2 Produits)

Synonymes: anticorps PP4R2, anticorps BE691708, anticorps C230060M08Rik, anticorps ppp4r2, anticorps fe11b04, anticorps wu:fe11b04, anticorps ppp4r2-B, anticorps wu:fa17h08, anticorps wu:fc23g05, anticorps protein phosphatase 4 regulatory subunit 2, anticorps protein phosphatase 4, regulatory subunit 2, anticorps protein phosphatase 4, regulatory subunit 2a, anticorps protein phosphatase 4 regulatory subunit 2 S homeolog, anticorps protein phosphatase 4 regulatory subunit 2 L homeolog, anticorps protein phosphatase 4, regulatory subunit 2b, anticorps PPP4R2, anticorps Ppp4r2, anticorps ppp4r2a, anticorps ppp4r2.S, anticorps ppp4r2, anticorps ppp4r2.L, anticorps ppp4r2b

Sujet: PPP4R2 is the regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). It may regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN complex leads to enhance the temporal localization of snRNPs, suggesting a role of PPP4C in maturation of spliceosomal snRNPs. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair.

Poids moléculaire: 47 kDa (MW of target protein)