C2orf42 anticorps (C-Term)

N° du produit ABIN632522

Détail du produit anti-C2orf42 anticorps

Antigène: C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))

Épitope: C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C2orf42 est non-conjugé

Application: Western Blotting (WB)

Specificité: C2 ORF42 antibody was raised against the C terminal Of C2 rf42

Purification: Affinity purified

Immunogène: C2 ORF42 antibody was raised using the C terminal Of C2 rf42 corresponding to a region with amino acids ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C2ORF42 Blocking Peptide, catalog no. 33R-4188, is also available for use as a blocking control in assays to test for specificity of this C2ORF42 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C2orf42

Antigène: C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))

Autre désignation: C2ORF42 (C2orf42 Produits)

Synonymes: anticorps C2orf42, anticorps chromosome 22 open reading frame, human C2orf42, anticorps chromosome 2 open reading frame 42 L homeolog, anticorps chromosome 2 open reading frame 42, anticorps C22H2ORF42, anticorps c2orf42.L, anticorps c2orf42, anticorps C2orf42

Sujet: The function of C2orf42 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 63 kDa (MW of target protein)