SPATA6 anticorps (Middle Region)
-
- Antigène Voir toutes SPATA6 Anticorps
- SPATA6 (Spermatogenesis Associated 6 (SPATA6))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPATA6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SPATA6 antibody was raised against the middle region of SPATA6
- Purification
- Affinity purified
- Immunogène
- SPATA6 antibody was raised using the middle region of SPATA6 corresponding to a region with amino acids SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR
- Top Product
- Discover our top product SPATA6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPATA6 Blocking Peptide, catalog no. 33R-8715, is also available for use as a blocking control in assays to test for specificity of this SPATA6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPATA6 (Spermatogenesis Associated 6 (SPATA6))
- Autre désignation
- SPATA6 (SPATA6 Produits)
- Synonymes
- anticorps HASH, anticorps SRF-1, anticorps SRF1, anticorps 1700062C23Rik, anticorps AI790763, anticorps Hash, anticorps KRP, anticorps Mash, anticorps spermatogenesis associated 6, anticorps SPATA6, anticorps Spata6
- Sujet
- SPATA6 belongs to the SPATA6 family. SPATA6 may play a role in spermatid maturation or sperm function.
- Poids moléculaire
- 54 kDa (MW of target protein)
-