CLPB anticorps

N° du produit ABIN632528

Détail du produit anti-CLPB anticorps

Antigène: CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLPB est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLPB Blocking Peptide, catalog no. 33R-7560, is also available for use as a blocking control in assays to test for specificity of this CLPB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLPB

Antigène: CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))

Autre désignation: CLPB (CLPB Produits)

Synonymes: anticorps HSP78, anticorps SKD3, anticorps AL118244, anticorps Skd3, anticorps ClpB homolog, mitochondrial AAA ATPase chaperonin, anticorps ClpB caseinolytic peptidase B, anticorps CLPB, anticorps Clpb

Sujet: CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.

Poids moléculaire: 78 kDa (MW of target protein)