TNNI3K anticorps (N-Term)

N° du produit ABIN632533

Détail du produit anti-TNNI3K anticorps

Antigène: TNNI3K (TNNI3 Interacting Kinase (TNNI3K))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TNNI3K est non-conjugé

Application: Western Blotting (WB)

Specificité: TNNI3 K antibody was raised against the N terminal of TNNI3

Purification: Affinity purified

Immunogène: TNNI3 K antibody was raised using the N terminal of TNNI3 corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TNNI3K Blocking Peptide, catalog no. 33R-5154, is also available for use as a blocking control in assays to test for specificity of this TNNI3K antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TNNI3K

Antigène: TNNI3K (TNNI3 Interacting Kinase (TNNI3K))

Autre désignation: TNNI3K (TNNI3K Produits)

Synonymes: anticorps CARK, anticorps Cark, anticorps D830019J24Rik, anticorps TNNI3 interacting kinase, anticorps serine/threonine-protein kinase TNNI3K, anticorps TNNI3K, anticorps LOC100592286, anticorps Tnni3k

Sujet: TNNI3K may play a role in cardiac physiology.

Poids moléculaire: 103 kDa (MW of target protein)