GM2A anticorps (N-Term)

N° du produit ABIN632538

Détail du produit anti-GM2A anticorps

Antigène: GM2A (GM2 Ganglioside Activator (GM2A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GM2A est non-conjugé

Application: Western Blotting (WB)

Specificité: GM2 A antibody was raised against the N terminal of GM2

Purification: Affinity purified

Immunogène: GM2 A antibody was raised using the N terminal of GM2 corresponding to a region with amino acids SWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GM2A Blocking Peptide, catalog no. 33R-8939, is also available for use as a blocking control in assays to test for specificity of this GM2A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GM2A

Antigène: GM2A (GM2 Ganglioside Activator (GM2A))

Autre désignation: GM2A (GM2A Produits)

Sujet: This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.

Poids moléculaire: 18 kDa (MW of target protein)