GAS8 anticorps (N-Term)
-
- Antigène Voir toutes GAS8 Anticorps
- GAS8 (Growth Arrest-Specific 8 (GAS8))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GAS8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GAS8 antibody was raised against the N terminal of GAS8
- Purification
- Affinity purified
- Immunogène
- GAS8 antibody was raised using the N terminal of GAS8 corresponding to a region with amino acids VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM
- Top Product
- Discover our top product GAS8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GAS8 Blocking Peptide, catalog no. 33R-9820, is also available for use as a blocking control in assays to test for specificity of this GAS8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAS8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GAS8 (Growth Arrest-Specific 8 (GAS8))
- Autre désignation
- GAS8 (GAS8 Produits)
- Synonymes
- anticorps CG14271, anticorps Dmel\\CG14271, anticorps zgc:66271, anticorps wu:fb93e12, anticorps MGC114774, anticorps Gas11, anticorps GAS11, anticorps Growth arrest specific protein 8, anticorps growth arrest-specific 8, anticorps growth arrest specific 8, anticorps growth arrest specific 8 S homeolog, anticorps Gas8, anticorps gas8, anticorps GAS8, anticorps gas8.S
- Sujet
- This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.
- Poids moléculaire
- 56 kDa (MW of target protein)
-