GDAP2 anticorps (N-Term)

N° du produit ABIN632550

Détail du produit anti-GDAP2 anticorps

Antigène: GDAP2 (Ganglioside-Induced Differentiation-Associated-Protein 2 (GDAP2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GDAP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: GDAP2 antibody was raised against the N terminal of GDAP2

Purification: Affinity purified

Immunogène: GDAP2 antibody was raised using the N terminal of GDAP2 corresponding to a region with amino acids CRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLA

Information d'application

Indications d'application: WB: 0.0625 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GDAP2 Blocking Peptide, catalog no. 33R-1801, is also available for use as a blocking control in assays to test for specificity of this GDAP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDAP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GDAP2

Antigène: GDAP2 (Ganglioside-Induced Differentiation-Associated-Protein 2 (GDAP2))

Autre désignation: GDAP2 (GDAP2 Produits)

Synonymes: anticorps MACROD3, anticorps dJ776P7.1, anticorps C77050, anticorps D3Ertd801e, anticorps ganglioside induced differentiation associated protein 2, anticorps ganglioside-induced differentiation-associated-protein 2, anticorps GDAP2, anticorps Gdap2

Sujet: The function of GDAP protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 56 kDa (MW of target protein)