TRAPPC1 anticorps (Middle Region)
-
- Antigène Voir toutes TRAPPC1 Anticorps
- TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRAPPC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TRAPPC1 antibody was raised against the middle region of TRAPPC1
- Purification
- Affinity purified
- Immunogène
- TRAPPC1 antibody was raised using the middle region of TRAPPC1 corresponding to a region with amino acids YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM
- Top Product
- Discover our top product TRAPPC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TRAPPC1 Blocking Peptide, catalog no. 33R-10152, is also available for use as a blocking control in assays to test for specificity of this TRAPPC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRAPPC1 (Trafficking Protein Particle Complex 1 (TRAPPC1))
- Autre désignation
- TRAPPC1 (TRAPPC1 Produits)
- Synonymes
- anticorps BET5, anticorps MUM2, anticorps D11Ertd172e, anticorps zgc:100969, anticorps MGC83988, anticorps bet5, anticorps mum2, anticorps trafficking protein particle complex 1, anticorps trafficking protein particle complex 1 L homeolog, anticorps TRAPPC1, anticorps Trappc1, anticorps trappc1, anticorps trappc1.L
- Sujet
- This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.
- Poids moléculaire
- 17 kDa (MW of target protein)
-