DNAJC12 anticorps
-
- Antigène Voir toutes DNAJC12 Anticorps
- DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DNAJC12 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DNAJC12 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE
- Top Product
- Discover our top product DNAJC12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DNAJC12 Blocking Peptide, catalog no. 33R-2668, is also available for use as a blocking control in assays to test for specificity of this DNAJC12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DNAJC12 (DnaJ (Hsp40) Homolog, Subfamily C, Member 12 (DNAJC12))
- Autre désignation
- DNAJC12 (DNAJC12 Produits)
- Synonymes
- anticorps DNAJC12, anticorps JDP1, anticorps Jdp1, anticorps mJDP1, anticorps DnaJ heat shock protein family (Hsp40) member C12, anticorps DnaJ (Hsp40) homolog, subfamily C, member 12, anticorps DNAJC12, anticorps dnajc12, anticorps Dnajc12
- Sujet
- This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Poids moléculaire
- 23 kDa (MW of target protein)
-