AGGF1 anticorps (Middle Region)
-
- Antigène Voir toutes AGGF1 Anticorps
- AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AGGF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AGGF1 antibody was raised against the middle region of AGGF1
- Purification
- Affinity purified
- Immunogène
- AGGF1 antibody was raised using the middle region of AGGF1 corresponding to a region with amino acids EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR
- Top Product
- Discover our top product AGGF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AGGF1 Blocking Peptide, catalog no. 33R-2818, is also available for use as a blocking control in assays to test for specificity of this AGGF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGGF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AGGF1 (Angiogenic Factor with G Patch and FHA Domains 1 (AGGF1))
- Autre désignation
- AGGF1 (AGGF1 Produits)
- Synonymes
- anticorps RGD1310888, anticorps AGGF1, anticorps LOC100037685, anticorps im:7146636, anticorps zgc:152959, anticorps DKFZp459G1317, anticorps GPATC7, anticorps GPATCH7, anticorps HSU84971, anticorps HUS84971, anticorps VG5Q, anticorps 2010009L17Rik, anticorps 2310029P06Rik, anticorps AW112072, anticorps Peg3, anticorps angiogenic factor with G patch and FHA domains 1, anticorps angiogenic factor with G-patch and FHA domains 1, anticorps Aggf1, anticorps AGGF1, anticorps aggf1, anticorps CC1G_06398
- Sujet
- The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain.
- Poids moléculaire
- 81 kDa (MW of target protein)
-