CAMK1D anticorps (Middle Region)
-
- Antigène Voir toutes CAMK1D Anticorps
- CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CAMK1D est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CAMK1 D antibody was raised against the middle region of CAMK1
- Purification
- Affinity purified
- Immunogène
- CAMK1 D antibody was raised using the middle region of CAMK1 corresponding to a region with amino acids KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS
- Top Product
- Discover our top product CAMK1D Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CAMK1D Blocking Peptide, catalog no. 33R-4567, is also available for use as a blocking control in assays to test for specificity of this CAMK1D antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMK0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CAMK1D (Calcium/calmodulin-Dependent Protein Kinase ID (CAMK1D))
- Autre désignation
- CAMK1D (CAMK1D Produits)
- Synonymes
- anticorps CKLiK, anticorps CaM-K1, anticorps CaMKID, anticorps A630059D12Rik, anticorps CaMKIdelta, anticorps E030025C11Rik, anticorps CAMK1D, anticorps camk1d, anticorps zgc:158713, anticorps RGD1560691, anticorps zgc:172284, anticorps cam-ki, anticorps camk1d.L, anticorps calcium/calmodulin dependent protein kinase ID, anticorps calcium/calmodulin-dependent protein kinase ID, anticorps calcium/calmodulin-dependent protein kinase 1Db, anticorps calcium/calmodulin-dependent protein kinase 1Da, anticorps calcium/calmodulin dependent protein kinase ID S homeolog, anticorps CAMK1D, anticorps Camk1d, anticorps camk1db, anticorps LOAG_08089, anticorps camk1da, anticorps camk1d.S
- Sujet
- This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
- Poids moléculaire
- 42 kDa (MW of target protein)
-