MSRA anticorps (Middle Region)
-
- Antigène Voir toutes MSRA Anticorps
- MSRA (Methionine Sulfoxide Reductase A (MSRA))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MSRA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MSRA antibody was raised against the middle region of MSRA
- Purification
- Affinity purified
- Immunogène
- MSRA antibody was raised using the middle region of MSRA corresponding to a region with amino acids YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS
- Top Product
- Discover our top product MSRA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MSRA Blocking Peptide, catalog no. 33R-10213, is also available for use as a blocking control in assays to test for specificity of this MSRA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSRA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MSRA (Methionine Sulfoxide Reductase A (MSRA))
- Autre désignation
- MSRA (MSRA Produits)
- Synonymes
- anticorps 2310045J23Rik, anticorps 6530413P12Rik, anticorps MSR-A, anticorps PMSR, anticorps methionine sulfoxide reductase A, anticorps Msra, anticorps MSRA
- Sujet
- This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 26 kDa (MW of target protein)
-